double-stranded DNA sequence: 5’-CAG AAG AAA ATT AAC ATG TAA-3’ 3’-GTC TTC TTT TAA TTG TAC ATT-5’ If the bottom strand serves as the template‚ what is the mRNA sequence produced by transcription of this DNA sequence and Why? 5’-CAG AAG AAA AUU AAC AUG UAA-3’ mRNA sequence 3’-GTC TTC TTT TAA TTG TAC ATT-5’ DNA template strand We get the mRNA sequence due the transcription process‚ which gives us the RNA bases that are complementary to the DNA template strand that uses uracil
Premium DNA Gene RNA
Outline the key strands of the sociology of work! The term work is expressed as performing duties involving the use of psychological and physical energy‚ for the purpose of the manufacture of goods and services in order to achieve an individuals needs (Gedden’s 2008). There are six key areas of thought in the sociology of work these include “managerial psychologist”‚ Durkheim systems”‚ Interactionist”‚ Weber Interpretivist”‚ Marxian and “Post structuralise and Post Modern” (Watson 2008). Sociology
Premium Sociology Émile Durkheim
promoter. He got a piece of DNA that had a good class 2 promoter and a piece of DNA that he knew he could cut with restriction endonucleases. The idea is to pair a piece of DNA with label on only one strand. In this case you want the label on the crick strand. You would take this piece of DNA with a hot phosphate on 5 prime end of the crick strand and denature it. The probe DNA helps you see where txn starts. You take that probe DNA and you mix it with transcript thats made by the enzyme. He lets the
Premium DNA Gene RNA
So the poet I decided to do this on is Mark Strand. He was born in Canada in 1934 and grew up in different places in the United States. He studied at several universities including Antioch Ohio college‚ Yale‚ also the University of Florence on a Fulbright fellowship where he studied 19th century Italian poetry. When he was a child‚ he actually wasn’t considered bright. He was a painter while studying at Yale‚ and a lot of people say that he creates a “painterly” image in his poetry because
Premium Poetry
1.) The only difference between the wild type and mutant sequence is a point mutation at gene 1755‚ where a guanine is replaced with an adenine. 2.) a.) Wild Type Protein Transcription: MQPTGNQIQQNQQQQQQLIMRVPKQEVSVSGAARRYVQQAPPNRPPRQNHQNGAIGGKKS SVTIQEVPNNAYLETLNKSGNNKVDDDKLPVFLIKLWNIVEDPNLQSIVHWDDSGASFHI SDPYLFGRNVLPHFFKHNNMNSMVRQLNMYGFRKMTPLSQGGLTRTESDQDHLEFSHPCF VQGRPELLSQIKRKQSARTVEDKQVNEQTQQNLEVVMAEMRAMREKAKNMEDKMNKLTKE NRDMWTQMGSMRQQHARQQQYFKKLLHFLVSVMQPGLSKRVAKRGVLEIDFCAANGTAGP
Premium Gene DNA Amino acid
In my research of the Fibonacci Numbers‚ I have found that the Fibonacci numbers appear anywhere from leafs on plants‚ patterns of flowers‚ in fruits‚ some animals‚ even in the human body. Could this be nature’s numbering system? For those who are unfamiliar with the Fibonacci numbers they are a series of numbers discovered by Leonardo Fibonacci in the 12th century in an experiment with rabbits. The order goes as follows: 1‚ 1‚ 2‚ 3‚ 5‚ 8‚ 13‚ 21‚ 34‚ 55‚ 89‚ 144‚ 233‚ 377‚ 610 and so on. Starting
Premium Fibonacci number Golden ratio
Fibonacci Sequence Fibonacci‚ also known as the Leonardo of Pisa‚ born in the early 1770’s AD in Pisa‚ Italy‚ has had a huge impact on today’s math‚ and is used in everyday jobs all over the world. After living with his dad‚ a North African educator‚ he discovered these ways of math by traveling along the Mediterranean Coast learning their ways of math. With the inspiration from the “Hindu-Arabic” numerical system‚ Fibonacci created the 0-9 number system we still use to this day. One of his
Free Italy
Sequence stratigraphy Sequence stratigraphy is a method of stratigraphic interpretation that combines the chronological order of the accumulation of sediments‚ their stratal architecture and the geometric relationships of their facies to determine depositional setting and predict stratal continuity. The workflow of sequence stratigraphic analysis first identifies the genetic units and bounding surfaces that compose the stratigraphic section in outcrop‚ core‚ well-log and seismic data. The framework
Premium Geology Sea level
30/12/2017 Lớp YK2 Bộ môn USMLE Trương Thành Nam Hướng dẫn: Ths. Đặng Thị Bích Thảo MSSV: 1400056 Essay project 2 Pierre Robin Sequence Introduction : Pierre Robin sequence (PRS) is a rare congenital defect‚ which was first described by Lannelongue Menard in 1891 as Pierre Robin syndrome. The word “syndrome” then was replaced by “sequence” because the pathogenesis of the condition occurs through a chain of events. The sequence include small jaw (micrognathia)‚ displacement of the tongue (glossoptosis)
Premium Mental disorder Psychology Schizophrenia
Questionbank Topic 1. Sequences and Series‚ Exponentials and The Binomial Theorem 1. Find the sum of the arithmetic series 17 + 27 + 37 +...+ 417. 2. Find the coefficient of x5 in the expansion of (3x – 2)8. 3. An arithmetic series has five terms. The first term is 2 and the last term is 32. Find the sum of the series. 4. Find the coefficient of a3b4 in the expansion of (5a + b)7. 5. Solve the equation 43x–1 = 1.5625 × 10–2. 6. In an arithmetic sequence‚ the first term is 5 and the
Premium Geometric progression Series Sequence