Preview

Protein Biochemistry

Good Essays
Open Document
Open Document
614 Words
Grammar
Grammar
Plagiarism
Plagiarism
Writing
Writing
Score
Score
Protein Biochemistry
Lab 2: Internet Resources for Protein Biochemistry

Part 1-1:
A)
Protein Accession Number = P00939

Name of Protein: Full Name = Triosephosphate isomerase; Short Name=TIM Organism where the protein is found: Oryctolagus cuniculus = Rabbit

Nuber of amino acids in the protein:
AA = 248

B) * Amino Acid Sequence: >gi|136066|sp|P00939.1|TPIS_RABIT RecName: Full=Triosephosphate isomerase; Short=TIM; AltName: Full=Triose-phosphate isomerase APSRKFFVGGNWKMNGRKKNLGELITTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALSEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIINAKQ

C)
Description:
This protein plays a significant role in the energy production of glycolysis and is found in practically every organism that acquires energy in this manner. This enzyme is essential to catalyze the conversion reaction between dihydroxyacetone phosphate and D-glyceraldehyde 3-phosphate.

Part 1-2:

The first human ortholog on the list derived from the BLAST of our Rabbit protein is called:
Chain A, Human Triosephosphate Isomerase Of New Crystal Form. Its ID# is 1WYI_A . It is 98% identical to our Rabbit TIM.

* This human protein has the 250 amino acids with the following sequence:

>gi|66360365|pdb|1WYI|A Chain A, Human Triosephosphate Isomerase Of New Crystal Form GSAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYK VTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGI TEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIINAKQ

Part 1-3: Alignment of Rabbit TIM (top) and


Cited: "Triosephosphate Isomerase." Wikipedia. Wikimedia Foundation, 16 Dec. 2012. Web. 18 Jan. 2013.
Continue Reading
View Writing Issues

You May Also Find These Documents Helpful

  • Good Essays

    Protein Modification Discussion
    • 468 Words
    • 2 Pages

    Protein Modification Discussion

    The graph was about turbidity reading at different temperatures at 340nm. The curve of egg white in the graph increased dramatically at first. At 80℃, the curve got a peak at 0.251. The peak was where the protein was fully denatured. Then, the curve dropped quickly. With the raising of the temperature, protein in the solution got denatured. When the temperature increased from 60℃ to 80℃, the structure of protein got unfold. When the solution was heated, the H-bond was broken. The hydrophobic parts of protein were inside the protein surrounded by hydrophilic parts before unfolding. With the temperature increasing, the hydrophobic parts were exposed. The hydrophobic parts of proteins interacted. The reason why the turbidity reading got bigger is that protein unfold and the unfold proteins got coagulation. The coagulation caused the turbidity of solution increasing. The melting temperature of the native egg white sample was at the half of denaturation. It is about 71℃. The curve dropped because coagulation floated to the surface of solution. The curve of succinylated egg white did not change much. The –NH3+ of protein in egg white was replaced by COO- at pH8, so the protein was negative charged. The fastest coagulation of protein is at pI (isoelectric point). Because the pH of solution was at pI, the whole process is slow.…

    • 468 Words
    • 2 Pages
    Good Essays
    Read More
  • Good Essays

    Sci 241 Protein Research Paper
    • 410 Words
    • 2 Pages

    Sci 241 Protein Research Paper

    Proteins are a part of every cell, tissue, and organ in our bodies. The protein we eat is broken down by amino acids that are later used to replace proteins in our bodies. These proteins include meats, poultry, fish, eggs, nuts, seeds, milk and milk products.…

    • 410 Words
    • 2 Pages
    Good Essays
    Read More
  • Good Essays

    biochemistry
    • 1235 Words
    • 5 Pages

    biochemistry

    Using the pK values shown in parentheses in the above diagram, select the pI of the tripeptide Arginiyltyrosinylcystyl from the following choices:…

    • 1235 Words
    • 5 Pages
    Good Essays
    Read More
  • Satisfactory Essays

    What is the function of the indicated protein?
    • 5107 Words
    • 28 Pages

    What is the function of the indicated protein?

    A catalyst is a substance that has the capacity to speed up chemical reactions without itself being…

    • 5107 Words
    • 28 Pages
    Satisfactory Essays
    Read More
  • Powerful Essays

    Protein: Summary
    • 802 Words
    • 4 Pages

    Protein: Summary

    ABSTRACT: In this lab, we are using a BioRad protein assay dye to determine the concentration of protein in our chicken. The dye binds to the amino acid residues, which allow us to find the concentration of protein (BioRad Protein Assay for Tissues). Our hypothesis was the longer chicken is cooked the less protein is available. To test our hypothesis, we made samples using our chicken and distilled water to determine how much protein was in the chicken. We found that our data supported our hypothesis; it showed that the longer our chicken was cooked the less protein that was in the chicken. As the chicken is cooked longer, the protein is denatured by the heat.…

    • 802 Words
    • 4 Pages
    Powerful Essays
    Read More
  • Good Essays

    6-Phosphogluconate Lab Report
    • 695 Words
    • 3 Pages

    6-Phosphogluconate Lab Report

    By RF was finding the molecular weight of the enzyme. The molecular weight of 6-PGD is 44 KDa. Studying properties (characterization) of the enzyme while the enzyme is more active in optimum temperature at 60°C, in Tris-HCl PH=8. 0 shown in the figure (4.4.) high activity. The optimum ionic strength was shown in 0.6 M Tris-HCl in figure (4.6.). The kinetic study supply how the reaction occurs in the present of enzyme and substrate. Find Vmax=0. 0078, Km= 0.058 at stable 6-PG, Vmax= 0.057, Km=0. 0015 at stable NADP+. The kinetic study provided how reaction took place and participation of a substrate with an enzyme to get production. The stability of PH in Tris-HCl shown in figure (4.7.) high activity of enzyme 6-PGD at PH=8. 0, stability of PH in K-phosphate shown in figure (4.8.) high activity of enzyme 6-PGD at PH=7. 0 in the period of time (every eight hours) until 32…

    • 695 Words
    • 3 Pages
    Good Essays
    Read More
  • Powerful Essays

    Isolation Of Formal Lab Report Essay
    • 1041 Words
    • 5 Pages

    Isolation Of Formal Lab Report Essay

    The raw data were searched against the protein database by Proteome Discoverer 1.4 software (Thermo Fisher Scientific, San Jose, CA) with SEQUEST as the search engine. The parameters were set as follow: database, human UniProt; enzyme, trypsin; fixed modifications, carbamidomethyl (C) and 4-plex iTRAQ (N-term and K); variable modification, oxidation (M); up to 2 missed cleavages allowed; mass tolerance, 10 ppm for MS1 and mass tag, 0.05 Da for MS2; 1% false discovery rate allowed for…

    • 1041 Words
    • 5 Pages
    Powerful Essays
    Read More
  • Powerful Essays

    Maple Syrup Urine Disease
    • 3482 Words
    • 14 Pages

    Maple Syrup Urine Disease

    Maple Syrup Urine Disease is a genetic disorder caused by mutation in the DBT, DLD, BCKDHB, and BCKDHA genes, which codes for Branched Chain Keto Acid Dehydrogenase (BCKD). Normally, BCKD would process the keto acid derivatives for leucine, isoleucine, and valine and continue them on their respective metabolic pathways. As a result of these breaks in the metabolic pathway, the patient may suffer from mental retardation, lethargy, poor feeding habits, vomiting, and seizures early in life. The name of this disease comes from its most distinctive symptom, the patient's urine having a burnt-caramel smell.…

    • 3482 Words
    • 14 Pages
    Powerful Essays
    Read More
  • Good Essays

    Proteins: Macromolecules In The Human Body
    • 224 Words
    • 1 Page

    Proteins: Macromolecules In The Human Body

    Proteins are a diverse group of macromolecules that are vital for many functions in the human body. Proteins can be used for energy, structural support, regulatory balance, contractile movement, hormones and protective coverings from foreign objects. Proteins serve as transportation and storage, and act as enzymes to help carry out chemical reactions. Proteins make up many structural components of the human body including bones, hair, fingernails, and toenails. Proteins are composed of chains called amino acids, which are linked together by peptide bonds. (Rye et. al., 2013). According to Galewska, a biology technician from University of Bialystok, states that a Biuret reagent is an aqueous solution composed of sodium hydroxide and copper (II)…

    • 224 Words
    • 1 Page
    Good Essays
    Read More
  • Better Essays

    Enzyme Lab Report
    • 3653 Words
    • 15 Pages

    Enzyme Lab Report

    1) catalytic subunit- consist of 6 protein subunits organized into two trimers. Can be separated by p-hydroxymercuribenzoate…

    • 3653 Words
    • 15 Pages
    Better Essays
    Read More
  • Good Essays

    Structures of Proteins
    • 716 Words
    • 3 Pages

    Structures of Proteins

    Proteins are polymeric chains that are built from monomers called amino acids. All structural and functional properties of proteins derive from the chemical properties of the polypeptide chain. There are four levels of protein structural organization: primary, secondary, tertiary, and quaternary. Primary structure is defined as the linear sequence of amino acids in a polypeptide chain. The secondary structure refers to certain regular geometric figures of the chain. Tertiary structure results from long-range contacts within the chain. The quaternary structure is the organization of protein subunits, or two or more independent polypeptide chains.…

    • 716 Words
    • 3 Pages
    Good Essays
    Read More
  • Good Essays

    Genetic Testing Research Paper
    • 719 Words
    • 3 Pages

    Genetic Testing Research Paper

    Every 3 nucleotides codes are for a specific amino acid. The amino acid sequence determines what protein will be made.…

    • 719 Words
    • 3 Pages
    Good Essays
    Read More
  • Better Essays

    Proteins
    • 1850 Words
    • 8 Pages

    Proteins

    A swap is an agreement between two institutions to exchange future cash flows. Suppose there is a bank receiving fixed 8% return on 2 year money lent. This bank can swap its revenue stream against another firm’s variable rate 2 year money. In practice swaps tend to be more complicated and can involve more simultaneous variations of interest rates and currency as well.…

    • 1850 Words
    • 8 Pages
    Better Essays
    Read More
  • Best Essays

    Migration Potential of Cancel Cells
    • 3511 Words
    • 15 Pages

    Migration Potential of Cancel Cells

    19. Munagala, Radha, Farrukh Aqil, and Ramesh C. Gupta. "Abstract." National Center for Biotechnology Information. U.S. National Library of Medicine, 30 Oct. 0005.…

    • 3511 Words
    • 15 Pages
    Best Essays
    Read More
  • Powerful Essays

    Thalassemia
    • 1441 Words
    • 6 Pages

    Thalassemia

    The gene controlling beta chain production is located on the short (p) arm of chromosome 11 at position 15.5. More precisely, The HBB gene is located from base pair 5,203,271 to base pair 5,204,876…

    • 1441 Words
    • 6 Pages
    Powerful Essays
    Read More

Related Topics